PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009112382.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 155aa    MW: 18315.4 Da    PI: 10.5646
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009112382.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.38.5e-253078452
          RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                    + s ed++ yF++pi++AAkeLgv+lT+LKr+CR++G +RWPhRk++s+
  XP_009112382.1 30 KFSREDMKPYFKMPITKAAKELGVGLTLLKRRCRELGFSRWPHRKLTSI 78
                    67899*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.4281498IPR003035RWP-RK domain
PfamPF020423.5E-213278IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MEIILHDGNN TTKETTMQKR RYRGDRLIQK FSREDMKPYF KMPITKAAKE LGVGLTLLKR  60
RCRELGFSRW PHRKLTSIDG LINNLKDHLG KMEGEVNRSK LMNALEILEA EKKMIEEFPD  120
LEFEDKTKRL RQACFKANYK RRRLLCSMST TSFVS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139143KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112382.11e-112PREDICTED: protein RKD3-like
RefseqXP_013658046.11e-111PREDICTED: protein RKD3-like
SwissprotQ9FGD12e-66RKD3_ARATH; Protein RKD3
TrEMBLA0A078G1X71e-111A0A078G1X7_BRANA; BnaA09g07620D protein
STRINGBra037130.1-P1e-103(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121801932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-67RWP-RK domain-containing protein